SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001078944.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001078944.1.100692
Domain Number 1 Region: 236-350
Classification Level Classification E-value
Superfamily Acid proteases 4.88e-26
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.77e-20
Family Ubiquitin-related 0.00000717
Further Details:      
 
Weak hits

Sequence:  NP_001078944.1.100692
Domain Number - Region: 145-190
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0719
Family XPC-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001078944.1.100692
Sequence length 408
Comment protein DDI1 homolog 1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCS
LGSYGLKDGDMVVLLQKDNVGPRPPGRAPNHPRTDFTGSGSAVPGTSSSRHPHPHQHHHH
QHQRIPSTQQAHGLASGENMAFAQDLNSPALIRSMLLSNPHDLSLLKERNPALAEALLSG
NLETFSQVLVEQQRERAMREQEMFRLYSADPFDQETQARIEEEIRQQNIEENMNIAMEEA
PESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVG
TQRIMGRVHLAQIQIEGDFLQCSFSILEEQPMDILLGLDMLRRHQCSIDLKKNVLVIGTT
GSQTHFLPEGELPLCAKLLSGAVQEDSSDKEVAGSIKHPVKGPGRKKH
Download sequence
Identical sequences A0JPP7
10116.ENSRNOP00000037523 NP_001078944.1.100692 NP_001078944.1.4139 ENSRNOP00000037523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]