SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001083730.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001083730.1.7800
Domain Number 1 Region: 30-148
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.59e-40
Family Frizzled cysteine-rich domain 0.000000348
Further Details:      
 
Domain Number 2 Region: 176-293
Classification Level Classification E-value
Superfamily TIMP-like 3.14e-26
Family Tissue inhibitor of metalloproteinases, TIMP 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001083730.1.7800
Sequence length 319
Comment Frzb-1 protein precursor [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MSPTRKLDSFLLLVIPGLVLLLLPNAYCASCEPVRIPMCKSMPWNMTKMPNHLHHSTQAN
AILAIEQFEGLLTTECSQDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARAGCEPILI
KYRHTWPESLACEELPVYDRGVCISPEAIVTVEQGTDSMPDFPMDSNNGNCGSTAGEHCK
CKPMKASQKTYLKNNYNYVIRAKVKEVKVKCHDATAIVEVKEILKSSLVNIPKDTVTLYT
NSGCLCPQLVANEEYIIMGYEDKERTRLLLVEGSLAEKWRDRLAKKVKRWDQKLRRPRKS
KDPVAPIPNKNSNSRQARS
Download sequence
Identical sequences P79993
gi|148234909|ref|NP_001083730| gi|1854030|gb|AAC60114| NP_001083730.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]