SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001086376.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001086376.1.7800
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.1e-32
Family cAMP-binding domain 0.000000621
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-32
Family cAMP-binding domain 0.000000495
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.96e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001086376.1.7800
Sequence length 381
Comment protein kinase, cAMP-dependent, regulatory subunit type I beta S homeolog [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MASGSTSSEEDRSLRECEQYVQKHNIQQLLKDCIVQLCTVRPACPMAYLREYFERLEKEE
TRQTLNQQKSGSRSDSREDEISPPPHMNSVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVVDQG
EMDVYVNNDWMTSIGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences Q6DJJ2
NP_001086376.1.7800 XP_018092994.1.7800 gi|147902986|ref|NP_001086376| gi|49523206|gb|AAH75186|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]