SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001089221.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001089221.1.7800
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily YggU-like 3.53e-27
Family YggU-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001089221.1.7800
Sequence length 121
Comment uncharacterized protein LOC734268 [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MPRKEGKGLKKDVSPVAPVTGPVSRDKTGSVTISIHAKPGAKQNAITDVTADAVGVAIAA
PPTEGEANAELCRYLSKVLVLKKSEVSLDKGGKSREKVVKISASITPEVVLERLKEAAVH
S
Download sequence
Identical sequences Q5HZ71
NP_001089221.1.7800 gi|148236990|ref|NP_001089221| gi|57920974|gb|AAH89152|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]