SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001089491.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001089491.1.7800
Domain Number 1 Region: 10-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000107
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001089491.1.7800
Sequence length 219
Comment ropporin-1-like protein [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MPPPETMFCAQQINIPPELPDILKQFTKAAIRTQPHDLLQWSAAYFDSLSKGEPLPVKDR
VELQVATQKTDSGLTPGLLKVLNKQLSSKMSVKIADLKQKWTDLCLPEEQLQNILGLDNF
QDDIDWLKFLSLGCSALGGSISSALKYACEILTEDPEGGAAHIPFDTFTYIYKYLAHIDG
DISEMQIEDVLNVLQSEAERQNGLIQPRNFLSSQCPLLS
Download sequence
Identical sequences A0A1L8FX61 Q4V7T8
NP_001089491.1.7800 gi|147907415|ref|NP_001089491| gi|66911082|gb|AAH97722| gi|82225861|sp|Q4V7T8|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]