SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001091167.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001091167.1.7800
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000098
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001091167.1.7800
Sequence length 148
Comment pleckstrin homology-like domain, family A, member 1 L homeolog [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MLESSCKVVKEGLLEKRSDGLLQLWKKKRCILTEEGLLLIPPKQLEQQQQPSQPAEPARI
KELHFSNMKTVDCVERKGKYVYFTVVMTEGREIDFRCPQDQGWNAEITLQMVQYKNRQAI
LAVKSTRQKQQHLVQPHGHRIRSASNSA
Download sequence
Identical sequences A1L2R3
gi|120538291|gb|AAI29675| gi|147902671|ref|NP_001091167| NP_001091167.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]