SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001092335.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001092335.1.59421
Domain Number 1 Region: 79-128
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000183
Family Elafin-like 0.00063
Further Details:      
 
Domain Number 2 Region: 28-75
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000157
Family Elafin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001092335.1.59421
Sequence length 131
Comment antileukoproteinase precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MKLSGLFPFMLLALGSLALWAVEGAENALKAGACPPRKTTQCLGDEKPKCRSDWQCPHKK
KCCLDTCGTECLDPVNVTNPVKKKPGTCPLVHGRCLMLKPLNHCETDDQCVGTLKCCNAV
CGKVCLSPMKA
Download sequence
Identical sequences A6H749
NP_001092335.1.59421 NP_001092335.1.76553 XP_005893677.1.15283 9913.ENSBTAP00000005424 ENSBTAP00000005424 ENSBTAP00000005424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]