SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001092562.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001092562.1.59421
Domain Number 1 Region: 136-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000329
Family EGF-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001092562.1.59421
Sequence length 247
Comment amphiregulin precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MRAPLLPPAPVVLSLLIFGSAHYTAGLDVNDTYSGKGEPFSGDHSADRFEVTSRSEISSA
SETPPGGELSSVIDYDYAEEYDKEPQISGYIVDDSVRVEQVVKPKKNKTESEKTSDKPKR
KKKGGKNGKNRRNRKKKNLCDTEFQNFCIHGKCTFLEQLETVSCQCYPEYFGERCGEKSM
KTQSMVDSDLSKIALAAIAAFVSAMTFTAIAVFITILLRRRYLRGYEGVAEERKKLRQEN
GNAHAVA
Download sequence
Identical sequences A5PJE7
NP_001092562.1.59421 NP_001092562.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]