SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001092618.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001092618.1.76553
Domain Number 1 Region: 187-394
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.28e-52
Family Ypt/Rab-GAP domain of gyp1p 0.00000375
Further Details:      
 
Domain Number 2 Region: 370-494
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001092618.1.76553
Sequence length 505
Comment TBC1 domain family member 22B [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAAENSKQFWKRSAKLPGSIQPVYGAQHPPLDPRLTKNFIKERSKVSTVPLKNKKASSFH
EFARNTSDAWDIGDDEEEDFSSPAFQTLNSKVALATAAQVLENHSKLRVKPERSQSTTSD
VPASYKVIKSSSDAQLSRNSSDSCLRNPLHKQQSLPLRPVIPLVARISDQNASGAPPMTV
REKTRLEKFRQLLSSHNTDLDELRKCSWPGVPREVRPVTWRLLSGYLPANTERRKLTLQR
KREEYFGFIEQYYDSRNEEHHQDTYRQIHIDIPRTNPLIPLFQQPLVQEIFERILFIWAI
RHPASGYVQGINDLVTPFFVVFLSEYVEEDVENFDVTNLSQDMLRSIEADSFWCMSKLLD
GIQDNYTFAQPGIQKKVKALEELVSRIDEQVHNHFRRYEVEYLQFAFRWMNNLLMRELPL
RCTIRLWDTYQSEPEGFSHFHLYVCAAFLIKWRKEILDEEDFQGLLMLLQNLPTIHWGNE
EIGLLLAEAYRLKYMFADAPNHYRR
Download sequence
Identical sequences A5PJP0 L8HVQ7 W5PYF9
NP_001092618.1.59421 NP_001092618.1.76553 XP_004018838.1.66739 XP_005906844.1.15283 XP_005964338.1.78601 XP_006079893.1.26621 XP_010846985.1.44457 XP_011967280.1.54773 XP_019841717.1.53367 XP_020741426.1.74333 ENSBTAP00000018938 ENSBTAP00000018938 ENSOARP00000015493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]