SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001101450.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001101450.1.4139
Domain Number 1 Region: 38-142
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.3e-16
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001101450.1.4139
Sequence length 262
Comment R-spondin-1 precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MRLGLCVVALVLSWTHLAVGSRGIKGKRQRRISAEGSQSCAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEGLYL
HKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRKGSEERTRRVL
HAPGGDQTNCSDTKETRKCTVRRTPCPEGQKRKKASQGRRENANRHPTRKNSKEPGSNSR
RHKGQQQPQPGTAGPLTSVGPT
Download sequence
Identical sequences D3ZBD1
ENSRNOP00000012811 10116.ENSRNOP00000012811 NP_001101450.1.100692 NP_001101450.1.4139 XP_008762241.1.100692 ENSRNOP00000012811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]