SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001102677.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001102677.2.4139
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.22e-50
Family PSF1 N-terminal domain-like 0.000000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001102677.2.4139
Sequence length 196
Comment DNA replication complex GINS protein PSF1 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MFCEKAMELVRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSAGRGDLIP
TIKFRHCSLLRNRRCTIAYLYDRLLRIRALRWEYGSVLPNPLRFHMSAEEVEWFNHYKKS
LATYMRSLGGDEGLDITQDVKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRW
KCEQLIRQGVLEHVLS
Download sequence
Identical sequences B2RZ16
10116.ENSRNOP00000010955 ENSRNOP00000010955 ENSRNOP00000010955 NP_001102677.2.100692 NP_001102677.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]