SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001116875.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001116875.1.66739
Domain Number 1 Region: 26-198
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.37e-45
Family MHC antigen-recognition domain 0.0000000946
Further Details:      
 
Domain Number 2 Region: 208-290
Classification Level Classification E-value
Superfamily Immunoglobulin 6.25e-18
Family C1 set domains (antibody constant domain-like) 0.0000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001116875.1.66739
Sequence length 354
Comment IgG receptor FcRn large subunit p51 precursor [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MRLPRPQPWGLGLFLVLLPGALSAENHRSLQYHFTAVSAPAAGTPAFWVSGWLGPQQYLS
YNNLRAQAEPYGAWVWESQVSWYWEKETTDLRNQEKLFLQALQVLGEGPFTLQGLLGCEL
GPDNVSVPVAKFALNGEEFMMFDPKLGIWDGDWPESRTVSIQWTKQPEAVNKEKTFLLYS
CPHRLLGHLERGRGNLEWKEPPSMRLKARPSSPGLSVLTCSAFSFYPPELKLHFLRNGLA
IGSGEIDMGPNGDGSFYAWSSLTVKSGDEHHYRCVVQHAGLAQPLTVELESPARTSMPVV
GIVIGFFLLLTVAAGGALLWRRMRKGLPASWISFRGEDVGALLPTPGLSKDGES
Download sequence
Identical sequences Q8HZV2
NP_001116875.1.54773 NP_001116875.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]