SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001117429.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001117429.1.80155
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000667
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001117429.1.80155
Sequence length 112
Comment B3 domain protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MLDELDGAMIISKTLTKTDIVGNVALPKAQVMSVLTRMNGVTDEGLDNGFEVQVHDIMED
DLYTVTLKRIDDMKYYFGTGWSTMKHSLDLVEGDVLKLYWDQFENKFIVLNF
Download sequence
Identical sequences Q1G3Z6
3702.AT1G43171.1-P NP_001117429.1.80155 AT1G43171.1 AT1G43171.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]