SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001121231.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001121231.1.7800
Domain Number 1 Region: 47-181
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-23
Family SH2 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001121231.1.7800
Sequence length 211
Comment uncharacterized protein LOC100158303 [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MVTLRWSCFHRCPCPSSIFAAMNRQAAQLSYHYKSFCGDYERVETALERLEASGYYWSTL
SGTEAKNLLSDQPVGSFLIRDSSDHHHLFTLSLRTSAGITNLRIKLEGPSFYLETVAGAE
TPHTFPCVVKLVEHYMRLTATGESDSNLCYIEGNDQPVPLMLTQPMNCKVVSLQYLCKRT
VVANMPPEASSSGENMEELPVSKMLRNAFRN
Download sequence
Identical sequences B1H1T7
NP_001121231.1.7800 gi|169642439|gb|AAI60733| gi|189217534|ref|NP_001121231|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]