SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001123417.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001123417.1.99540
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.19e-40
Family Cofilin-like 0.00000183
Further Details:      
 
Domain Number 2 Region: 168-325
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.16e-33
Family Cofilin-like 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001123417.1.99540
Sequence length 349
Comment twinfilin-2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MAHQTGIHATPELKDFFAKARNGSIRLIKVIIEEEQLVLGSHKELKHAWDQDYDALVLPL
LDESEPCYILYRLDSQNAQGYEWIFLSWSPDHSPVRLKMLYAATRATVKKEFGGGHIKDE
IFGTLKEDIALGGYKKHVSSCAAPAPLTAAERELQEIKINEVKTEISVESKQQTLQGLSF
PLRPEAEGAILLLKQKKINYIQLRLDLEKETVDLVHTKHTELKDLPGRIPQDTARYHFFL
YKHSHEGDHLESVVFIYSMPGYKCSIKERMLYSSCKNKLLDSVEQDFQLEIVKKIEIEDG
AELTDEFLYDEVHPKQHAFKQAFAKPKGPAGKRGQKRLIKGPGENGEDS
Download sequence
Identical sequences Q0VFJ9
NP_001123417.1.99540 gi|110645741|gb|AAI18803| gi|194018662|ref|NP_001123417|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]