SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001125338.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001125338.1.23681
Domain Number 1 Region: 25-51
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000598
Family RING finger domain, C3HC4 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001125338.1.23681
Sequence length 70
Comment E3 ubiquitin-protein ligase RNF114 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MAAQQQDGGGAAQLAGPAAEVDPLGRFTCPVCLEVYEKPVQVPCGHVSSCPRSGPTWLRV
PNTRITSWKV
Download sequence
Identical sequences Q5RC83
NP_001125338.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]