SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001126110.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001126110.1.23681
Domain Number 1 Region: 99-191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000384
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001126110.1.23681
Sequence length 207
Comment suppressor of IKBKE 1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASD
MKDMSKYKPHILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKK
AVDAEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQMDDDQFCKIQEKLAQLELENKEL
RELLSISSESLQARKENSMDTASQAIK
Download sequence
Identical sequences Q5R8J5
ENSPPYP00000001160 NP_001126110.1.23681 ENSPPYP00000001160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]