SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001149409.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001149409.1.34533
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000458
Family FAS1 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001149409.1.34533
Sequence length 182
Comment uncharacterized protein LOC100283035 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MAPXNAAFDKMKAGVLNGLSPQDQIQLVLYCVLPRFYSLSMLGTLDGKVNTQGSGHDGPY
RYDIKRSGNNVNVSTGVNWMLLGSPVSKDFPLAIYPVDKVPLPYELFGPKPPTPAPAPAP
APAKSKTKKKKKAAGIAEPPTADDDTSASDDQKAAAAPGTAGSWTATALSALAAAALGAG
LF
Download sequence
Identical sequences B6TE21
NP_001149409.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]