SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001157221.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001157221.1.92730
Domain Number 1 Region: 1108-1247
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.88e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000165
Further Details:      
 
Domain Number 2 Region: 229-316
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000871
Family Calponin-homology domain, CH-domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001157221.1.92730
Sequence length 1253
Comment calmodulin-regulated spectrin-associated protein 3 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MVEAAPAGSGPLRRTFLVPEIKSLDQYDFSRAKAAASLAWVLRAAFGGAEHVPPELWEPF
YTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLEPSPSPSALLALLARRGTVPSLPEH
PVREADLKHQPILMGAHLAVIDALMVAFSFEWTKTLPGPLALSSLEHKLLFWVDTTVRRL
QEKTEQEAAQRASPAAPLDGASPAQPSIRYRKDRAIARRAPCFPNVTTLQDLASGAALAA
TIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASHLPRGCPLSLEDLLYVPPPLK
VNLVVLLAEMYMCFEVLKPDFVQAKDLPDGHVAVSPRNTETVPSQNNSGSSSPVFNFRHP
LLSPGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDVDV
VMGDPVLLRSVSSDSLGPPRPVSTSSRNSAQPAPESGDLPTIEEALQIIHSAEPRLLPDG
AADGSFYLHSPEGLSKPPLSPYPPEGASKPLSDRLNKAPIYISHPENPSKSSPCSTGEIL
KPPPPSEGSPKAVASSPAANNSEVKMTSFAERKKQLVKAEAESGLGSPTSTPVAPEALSS
EMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREAAGEAEEEAELGSV
PGGERPAGEGQGEPSLRHKSVTFSPDLGPVPPEGLGDYNRAVSKLSAALSSLQRDMQRLT
DQQQRLLAPPEAPGPAPPPAAWVIPGPATGPKAASPSPARRAPAARRSPGPGPSPTPRSP
KHARPAELKLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLSEGTPPEEPTTKP
ALIEIPLASLGEPAADEEGDGSPPGAEDSLEEEASSEGEPRSGLGFFYKDEDKPEDEMAQ
KRASLLERQQRRVEEARRRKQWQEAEKEQKREEAARLAQEAPGLAFTTPVVASAAPVATL
APTTRAMAPAEEEVGPRRGDFTRLEYERRAQLKLMDDLDKVLRPRASGTGGPGRGGRRAT
RPRSGCCDDSALARSPARGLLGSRLSKVYSQSTLSLSTVANEAPNNLGVKRPTSRAPSPS
GLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAG
KVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPA
MVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTTPKKGGGTPK
Download sequence
Identical sequences ENSMUSP00000125993 NP_001157221.1.92730 ENSMUSP00000125993 ENSMUSP00000125993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]