SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001167055.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001167055.1.97760
Domain Number 1 Region: 24-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-84
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 271-393
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-34
Family Spectrin repeat 0.000000564
Further Details:      
 
Domain Number 3 Region: 507-628
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-31
Family Spectrin repeat 0.00000417
Further Details:      
 
Domain Number 4 Region: 394-504
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-25
Family Spectrin repeat 0.00000393
Further Details:      
 
Domain Number 5 Region: 631-743
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-23
Family Spectrin repeat 0.00000225
Further Details:      
 
Domain Number 6 Region: 742-888
Classification Level Classification E-value
Superfamily EF-hand 2.87e-20
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001167055.1.97760
Sequence length 896
Comment alpha-actinin-1 [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MPTFDMDPYDGDENNYMPQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIE
EDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALHYITSKGVKLVSIGAEEIV
DGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDG
LGFCALIHRHRPELIDYGKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEK
AIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPW
LENRAPENTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPS
EGKMVSDVSNAWGGLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHETWTEGKEVM
LQARDFETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARC
QNICDQWDALGALTQKRNEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTF
IVHTIEEIQGLSTAHEQFKATLPEADKERGAILGIHNEISKIVATYHVNMAGSNPYTTIN
PQDINAKWDKVRHLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRI
SIEMHGTLEDQLTHLRQYEKNIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVG
WEQLLTTIARTINEIENQILTRDAKGISQDQMNEFRASFNHFDRDHSGTLGAEEFKACLI
SLGFDIANDAQGEAEFSRIMSIVDPNRVGVVTFQAFIDFMSRETADTDTADQVMASFKVL
AGDKNYILADELRRELPPDQAEYCIARMAPYAGPDAIPGALDYMSFSTALYGESDL
Download sequence
Identical sequences C0H9I5
NP_001167055.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]