SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001178293.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001178293.1.76553
Domain Number 1 Region: 2673-2961
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 1280-1459
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-52
Family DBL homology domain (DH-domain) 0.0000000135
Further Details:      
 
Domain Number 3 Region: 1921-2114
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-50
Family DBL homology domain (DH-domain) 0.000014
Further Details:      
 
Domain Number 4 Region: 1466-1586
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 2115-2232
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-31
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 6 Region: 2555-2664
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-25
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 7 Region: 2471-2575
Classification Level Classification E-value
Superfamily Immunoglobulin 2.81e-24
Family I set domains 0.0066
Further Details:      
 
Domain Number 8 Region: 278-414
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 1098-1235
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-17
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 10 Region: 500-641
Classification Level Classification E-value
Superfamily Spectrin repeat 2.11e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 11 Region: 842-1001
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000336
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 12 Region: 2321-2384
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000101
Family SH3-domain 0.0000323
Further Details:      
 
Domain Number 13 Region: 1645-1710
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000366
Family SH3-domain 0.0033
Further Details:      
 
Domain Number 14 Region: 35-181
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000196
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 15 Region: 191-309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 16 Region: 646-766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000089
Family Spectrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001178293.1.76553
Sequence length 2986
Comment kalirin [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MTDRFWEQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIM
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQ
QKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLE
SLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYI
HRNNVSMPSAASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAK
QALDWIQETGEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVE
KGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPP
GILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKP
DSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELK
EGLEVMLSVPKRANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFL
FEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVL
KASNIETKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKQRNNSKRDGVEDVDSQGD
GSSQPDTISIASRTSQNTADSDKLSGGCELTVVLQDFNAGHSSELSIQVGQTVELLERPS
ERPGWCLVRTTERSPPQEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSE
SVANLQAQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSF
DLGSPKPGDETTPQGDSADEKSKKGWGEDEADEESHTPLPPPMKIFDNDPTQDEMSSSLL
AARQASTEVPTAADLVSAIEQLVKSKLSLEGGSYRGSLKDPTGCLNEGMTPPTPPRNLEE
EQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIH
QIYDWHKDVFLGELEKCIQEQDRLAQLFIKYERKLHIYVWYCQNKPRSEYIVAEYDAYFE
EVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKR
CNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELL
RKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALLNRETSERVILQAANADIQQAWVQD
INQVLETQRDFLNALQSPIEYQRKERSTAVMRSQPARVPQASPRPYSSIPVGSEKPPKGS
SYNPPLPPLKISTSNGSPGFDYHQAGDKFEASKNDLGGCNGASSMAVIKDYYALKENEIC
VSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILTPLTKAMAATENSDGSIKKS
CSWHTLRMRKRAEVENTGKNEATGPRKPKDILGNKVSVKETNSSEESECDDLDPNTSMEI
LNPNFIQEVAPEFLVPLVDVTCLLGDTVTLQCKVCGRPKPTITWKGPDQNILDTDNSSAT
YTVSSCDSGEITLKICNLMPQDSGIYTCIAANDHGTASTSATVKVQGVPAAPNRPIAQER
SCTSVILRWLPPSSTGNCTISGYTVEYREEGSQAWQQSVASTLDTYLVIEDLSPGSPYQF
RVSASNPWGISLPSEPSEFVRLPDYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKK
CIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELM
DDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRV
KLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPF
LDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQP
HNGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRLNQGT
Download sequence
Identical sequences NP_001178293.1.59421 NP_001178293.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]