SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001179074.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001179074.1.59421
Domain Number 1 Region: 233-306
Classification Level Classification E-value
Superfamily Homeodomain-like 2.22e-26
Family Homeodomain 0.00072
Further Details:      
 
Weak hits

Sequence:  NP_001179074.1.59421
Domain Number - Region: 56-66
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00837
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001179074.1.59421
Sequence length 349
Comment homeobox protein GBX-2 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPP
PPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQE
AAAARKFAPQQLPGGGSNFDKPEALQADAEDGKGFLAKEGSLLAFSAAEAVQASLVGAVR
GQGKDESKVEDDPKGKEESFSLESDLDYSSDDNLTGQAAHKEEDPGHALEETPPSGGAAG
STTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRR
AKWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP
Download sequence
Identical sequences E1BJ47
NP_001179074.1.59421 NP_001179074.1.76553 ENSBTAP00000011716 9913.ENSBTAP00000011716 ENSBTAP00000011716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]