SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001188983.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001188983.1.81976
Domain Number - Region: 31-60
Classification Level Classification E-value
Superfamily RING/U-box 0.0165
Family RING finger domain, C3HC4 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001188983.1.81976
Sequence length 67
Comment uncharacterized protein Dmel_CG42867 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSTDSNCPNCDSHTMVRRSRLAISRFKKLKMDFCAICCGHRYCGVGIYESYYKCSSCGWK
GDPNRSP
Download sequence
Identical sequences A0A0B4JCV2
NP_001188983.1.81976 FBpp0293067 FBpp0293067 FBpp0293067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]