SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001189149.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001189149.1.81976
Domain Number 1 Region: 113-234
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.84e-33
Family cAMP-binding domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 243-366
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.14e-28
Family cAMP-binding domain 0.00000274
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.44e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001189149.1.81976
Sequence length 377
Comment protein kinase, cAMP-dependent, regulatory subunit type 1, isoform AC [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSYMMAKTLEEQSLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQ
VKLDASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTM
NALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVF
VNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKM
YEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQ
RSEQGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCAD
ILKRNITQYNSFVSLSV
Download sequence
Identical sequences A0A0J9RZ66 A0A0Q5UKR3 A0A0R1DYT5 M9MRY3
NP_001189147.1.81976 NP_001189148.1.81976 NP_001189149.1.81976 XP_015014129.1.56816 XP_015050801.1.41174 XP_016032747.1.80810 FBpp0291781 FBpp0291782 FBpp0291783 FBpp0291781 FBpp0291782 FBpp0291783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]