SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001242228.1.40590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001242228.1.40590
Domain Number - Region: 38-85
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0497
Family Transducin (heterotrimeric G protein), gamma chain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001242228.1.40590
Sequence length 209
Comment uncharacterized LOC100783447 [Glycine max]; AA=GCF_000004515.4; RF=representative genome; TAX=3847; STAX=3847; NAME=Glycine max; cultivar=Williams 82; AL=Chromosome; RT=Major
Sequence
MATTPTTVRSSSVPSLPPPSPKSPPEYPDLYGKRRETARVHTLEREITFLEEELKSVEGL
QPASRCCKEIADYVMANADPLLPSTKKNRRSCRFWKWLCGMPCFNLSWICCCCCCEGLSL
QLKLPRCCCDCKPCSCSCSCLPPIKCCSLPKWSCCCSCPKSNCCKEGCGFGNCCTFPRSC
NFGCPTCPSCPSCCSCKCTCTCSCPSCPM
Download sequence
Identical sequences C6TBT5
NP_001242228.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]