SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001243069.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001243069.1.87134
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.91e-33
Family Gelsolin-like 0.00000141
Further Details:      
 
Domain Number 2 Region: 229-332
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.91e-26
Family Gelsolin-like 0.00000184
Further Details:      
 
Domain Number 3 Region: 134-208
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.21e-20
Family Gelsolin-like 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001243069.1.87134
Sequence length 333
Comment macrophage-capping protein isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSH
LHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
VESAFHKTSTGAPAAIKKLYQVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGG
KSNILERNKARDLALAIRDSERQGKAQVLGPKPALKEGNPEEDLTADKANAQAAALYKVS
DATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEG
FISRMQYAPNTQVEILPQGHESPIFKQFFKDWK
Download sequence
Identical sequences ENSP00000387063 ENSP00000387063 NP_001243069.1.87134 NP_001243069.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]