SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001246312.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001246312.1.81976
Domain Number 1 Region: 219-327
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.25e-31
Family Calponin-homology domain, CH-domain 0.0000275
Further Details:      
 
Domain Number 2 Region: 3154-3312
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-26
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 4174-4295
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 338-455
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 4351-4512
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 3926-4068
Classification Level Classification E-value
Superfamily Spectrin repeat 1.34e-22
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 7 Region: 5130-5205
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.96e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 8 Region: 2403-2552
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-22
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 2740-2873
Classification Level Classification E-value
Superfamily Spectrin repeat 9.72e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 10 Region: 3266-3415
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 11 Region: 3700-3848
Classification Level Classification E-value
Superfamily Spectrin repeat 6.62e-21
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 12 Region: 4618-4730
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-20
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 13 Region: 745-866
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 14 Region: 1906-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 15 Region: 4070-4184
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-17
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 16 Region: 1464-1593
Classification Level Classification E-value
Superfamily Plakin repeat 8.37e-17
Family Plakin repeat 0.0029
Further Details:      
 
Domain Number 17 Region: 3376-3521
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 18 Region: 4728-4841
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 3579-3705
Classification Level Classification E-value
Superfamily Spectrin repeat 2.81e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 20 Region: 656-787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000176
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 21 Region: 4795-4917,4989-5019
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000021
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 22 Region: 2121-2244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000227
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 23 Region: 4517-4626
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000106
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 24 Region: 5039-5149
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000109
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 25 Region: 2933-3091
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000164
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 26 Region: 2667-2768
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 27 Region: 2309-2443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000023
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 28 Region: 1225-1326,1360-1384
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000317
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 29 Region: 1809-1916
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000158
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 30 Region: 1676-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000173
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 31 Region: 3818-3921
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000396
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 2522-2644
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000158
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 33 Region: 1596-1707
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000464
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 34 Region: 1153-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000082
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 35 Region: 594-688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000301
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 36 Region: 994-1143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000331
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 37 Region: 426-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000489
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  NP_001246312.1.81976
Domain Number - Region: 872-926
Classification Level Classification E-value
Superfamily SH3-domain 0.000138
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001246312.1.81976
Sequence length 5462
Comment short stop, isoform AC [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MHSSSQSTLKRTQQLVRQTNGGRGDVLSSGSEVVHSSRGPAITTNIDDSNLRYRHETKRE
RTVEAVITDYPGVSPLGSVPHERTNFERTVTFQDPTGNSRRLSETGALVPAGAIPTSSTH
YQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRVTTHIVRKVTTLSRAEENAQPAEDLL
PPAKMIRSSELEYRRALPPAIESSSTQRREISDIVVGKEDNVSAREALLRWARRSTARYP
GVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLL
DPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCRE
KTAYLQERSFPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQIYKELERYFETVGEVD
VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLE
GRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKK
VNKLHQRWAQLRTNFHTNLVQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEH
IEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELA
LYQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ
LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLL
QLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQD
LREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTL
LDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRL
RQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREM
DEVNRLFDEFEKRARAEEESKQASRIFTEECLAIKSKLEDMARELDQIILAPLPRDLDSL
EHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHK
DRLKLLEASLAGLEDNEHVISELENELARHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQ
MDKMNDAADQLGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMK
NLQSSVQVEESWVDGTTERLSAMPTATSAYELDKLLGAAIERKPKIENVNVAGGRLIREA
KIYDSKCLRFVDWLVEARPSFSPPRRDLRPADSDPGATQYYSQRLDNLNTKNDRLLEQLS
QRLKTAIEVNGSDGLQYAESLQKPLKTFRVDFSAGSVPTGDGYAARQEDLYTTTYSTTQI
SSTKTTKSSTKSVYSSDGLDAASQEVSTAGLPQSQIQFNEIRTLKRSQQLGGHSVLDIAG
IRDPRTGRVLTIGEAIQLRILDVRTGEMLVGDRRITLEQAADQGLIDLQLAKQLLEPGAG
RDASGRELSLLEVIQREISEAESGYETAEKRIKQAVFEKFNMCEENVNDLLKWVTTVEQK
ISSVGGPREKIDELRNQINALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTT
LENSGRELRSRVDRVNDRTVRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERS
LSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERL
PHVEPLSSAESPIRQEVSLVSAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLR
SVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQL
SPMEINQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDK
FKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVE
SNLNDVTVKFEKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLL
STEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNIN
ISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKP
ICKDYRDYAPTIDKINDIGAQYDALIRPESPARKRSTYSPIKRTSPLRRMSGDARSPSPT
KGGILSPLSTGSSGFGSRRSSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDN
LNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDT
TKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLK
SWLDSKERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAG
TPDAQAVEIKLKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNL
DTLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAAL
EKQYLALQKKLDTKKAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQ
HQIDTHEPIYREVMAREHEVIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDR
HTRLQTCMEHCKKYSQTSETFLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVW
KHSGEFENTKGLGETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLD
DFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALA
KDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLG
IDLNDLETEIEKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFA
ADTTQTREQISTLRKTLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFK
RMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKD
LEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDY
KVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDAL
TDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHD
RLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALL
AESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHAS
NVESTVESGAELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFH
EAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQLSPGEGA
ATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREAD
LPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDL
KEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQIT
LQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLEL
RERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMD
DLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLD
DILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPE
VEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHE
TLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRGLKRQ
AVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLV
WINKTDSTLDQLKPIPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGS
VEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIG
ASKPVGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHT
LRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVL
ETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERV
VSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIG
KLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQ
RKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQK
RAAQMQGVLKTGRDLERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLN
ARVQALFDWLDHAEHKLRYAKNAPDDEKVSREMMDIHMDFMKDLRVREREKTETFEYAED
IINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLS
GLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSR
SGKTPVRGSSHDLREQSPDGTLRRQSFKGSRDQGLNARKGSRITPTRDTPDRDRLPHYGP
RFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDW
RKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDR
NGEGLIDWQEFIAALRPDWQERKPANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRF
GDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRAKGRTNIELREQFILADGVSQS
MAAFTPRRSTPNAAATASSSPHAHNGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRS
SLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSK
PPSRHGSTLSLDSTDDHTPSRIPQRKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTST
ITRKTASGSASPAPTRRNISGSSTPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPF
RL
Download sequence
Identical sequences A0A0B4K788
NP_001246312.1.81976 FBpp0293392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]