SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001247116.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001247116.1.81976
Domain Number 1 Region: 60-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-35
Family SPRY domain 0.013
Further Details:      
 
Domain Number 2 Region: 1260-1309
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000326
Family RING finger domain, C3HC4 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001247116.1.81976
Sequence length 1332
Comment CG6752, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSISKLFVKVFNEDIFEQVDHDNLYSDLDDDLEGANCSTVPDPRPAKLADLSVTKQMLIV
RTWLDDKFQQIQTDSNEEIRRLYMETESRIGPDLTIFDVDYTTTVRVSSDRLALRSQGSF
NTVRANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQFNENSGVGDTKSSYGYDGSKQQIW
HISTKKYGDKWQIGDVIGVTIDVDKEVIEYYRNGRSMGVAFNKLEKGPGISFFAAISLGY
TQGIEANFGNRPFMYPVSGFQPLMARPILKLQRANLLMNYLVNLAGIFSKYNAQSGMAPT
NGADARVSTKKTVYCIFATLLIEKFTNEIFDPYIIEDVLLRKISSMTNLASEKENSYSVL
HGLLSLFWNYMEGDEIKFVLRKLVNALLGTFTHTIQGLDYEKHRQALGMLHCLCLHEQTR
KYLLEGKLFKKHCLAFFLYIHPLEFYIMEELLPDSMAWTEGIDGPKEKYLNVVEKVRKVT
EPLYTAQKDLLCTLMINSDGSRESPSSRSIFLSKLRRYVIDLSMEQRPFHAFFFMQSSIQ
HPLDAPVALAFASILIDQTRSMFKDEMPTKNVEVNSDYFIDGTFDYMHFDRVGGVLSHLR
KVHRGDIDARLGSARTQQIYEDDRQNLRVNEVDTTLYLLGENINNVPVVGHTQGANNTTY
THFLNTRPNSSTDSSPGNADMEASLCELLDLCIIFYYSAGHKYIVKIATVRDEIAALNEV
LKETKFYREDIERKLGALEQHANVCMNENHQHVMGELRSKFSQRQNVFATRSIALARKQV
WLRGVALNNHRRSLLIWLLERMLRTLTTASNTGSLFSFVPEVYVNTLPILLDAVMDFSHH
DLKAQFEASDAECSVNAAAEFLGIHSADPRIVLASCKDSLLQALGTLTCHKSGVRALERT
SKRSQASLVRALLRPYENRAWGQSNWLLLRFWMGEGYAYKDSRQPSVWQGGSLPLHQGLC
RSRSRNETHTGLLHNVAPANPSKHFQRLIGAKLLEDEPFATAFLNSVLSQLNWAFSEFIL
LLQEIQNTAQRQENTLFEPKQLKICSMCFELTVSLMRCLEMVITTAPEIVTDESRPNSDL
LLNRICQLISQVLSRVTVPPGCFQFVVDMCSADLNAVTHYPIVTAALGILLALMQEEMES
DLRPQIVTRVSRAFLTDPSFQFATLEFALGEIRTPLLEQKNIPRGNFDPSSRPHIDPLTN
DVRVPLPNNSKRIRADPPILKFALNDFPSHVSSEEIDNVRRLIDSLRVKQTLLSDITLPS
EDSLCPICCAKPITAVFTPCKHQSCSDCIMQHMMNSKVCFYCKTTIQTIETLDGTVIFSN
DDVVQTPMIERA
Download sequence
Identical sequences Q9VFC4
FBpp0082488 FBpp0082488 NP_001247116.1.81976 NP_650425.1.81976 7227.FBpp0082488 FBpp0082488 FBpp0297356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]