SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001247185.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001247185.1.81976
Domain Number 1 Region: 435-539
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-26
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 2 Region: 707-836
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-20
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 3 Region: 845-970
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-19
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 4 Region: 271-405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000981
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 5 Region: 564-691
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000196
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 6 Region: 984-1022
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001247185.1.81976
Sequence length 1188
Comment uncharacterized protein Dmel_CG42613, isoform E [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MASAQIRHFYNTPTTISSTTTRQPLQQQQHTNNCNCISRKQFQNDTFLCHTQTQSESEAA
TATTTAAATLCQSTLAAAATSATGTTATAAATDDVPASECPQSWTTDENSDSDRDTQHRM
RNPLDDIAAGRNVAVLPVVQQQQDLADTAAPLVASTGISEQDRLATSTCLSRLSSKVSQD
STKQQRKLYQHGEATKDYAAAASTTPAVGILTDMQKFARSIFPLVIIFNLLPLFYAGGAH
LKSNGADGEPWMQPVVAYLEVSSRPTKSPKCDQTFVSRIGGPQNGSFSAPLLHNHRNHSR
QCLYTFLAGPGQRVEVVFKSFNLRGSPPDGSAVGELPSCVHEYMDIYSEVQSSEPAELIN
SPFGGRYCGTIPPRRRISMYRAVAISFFSNKNVTTDLFEGTFRFINASEYEIGIPIAGSP
CSYTITPSMSVNKTGALISPTYPGAYPKDMSCTYQFLGESNQRVRLEFRDFDLFFGGPHC
PFDYVKVYDGPDNSSALIGTYCGQQRNLVLYSSESSLFVHFYTLSRTANTQNRGFKGIYE
FSESFVKLDFIRENDGIHIRGSECDQKILSKKESTGFVLSPNYPYPYIPKTVCRYFIYGM
QDAQHLERVRLEFNAFNIPKVEHKDKSESNCTDGYLKIYLKGQETADAYDKFDYELCGNE
TQRVISEGPRLAMVFSSGELQGRGFKGKYTFETEYKIPGTAAPDGTCSFTYVSSSKKRGE
LNSPRYPSNYPSDTNCSYLFLAEADEQVTIVFDHFKIKADNNANATAGAYGSGACFEDWL
EMYVVYRDNNDRLLGRYCGQTAPGPVESPRGAVGLRITLHTDQESVASGFKARYFFESAK
SDAGDCGGNFSNQDSGLITSPNWPAGYKAPGRGMASNACNWVMKARPGYKLSIHFEQFGL
EGDPANRGCPAAVLRLWMNVDSDQPPLELCGEKPPVEQWHYTSTGQTARISFTTSDKTVG
AQGFRIVWTEIQDSGPGPPSVGLHCESTYHFQCGAGYCISDKLRCDGVKNCGPGDDTDEL
HCTTEAAEEDYDVLIIITLLVVSSLICLLCILCHSRRSRRNHVRQLGLHRNAHYDSQTSA
TAGLSSSRRHLQSGGASIAGSLHGINSGNLIIPPAPLPPTSVPPPPHICIAGVDMGMGMG
MGHGLMSNGEDDDDDLELDEDQLDADIFINDVHFDEDNIDHVNQMANV
Download sequence
Identical sequences A0A0B4K760
FBpp0293228 FBpp0293229 NP_001247185.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]