SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001253034.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001253034.1.72884
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.49e-40
Family Single strand DNA-binding domain, SSB 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001253034.1.72884
Sequence length 121
Comment replication protein A 14 kDa subunit [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MVDMMELPRSRINVGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD
EEISGIMEVVGKVTTKATILCTSYVQFKEDNHPFDLGLYNEAVKIIHEFPQFYPLGIVQH
D
Download sequence
Identical sequences A0A096MYR6 A0A2K5L8H6 A0A2K5VY20 A0A2K5Z904 A0A2K6E6W6 F6TGA8
9544.ENSMMUP00000001149 ENSMMUP00000001149 ENSMMUP00000001149 NP_001253034.1.72884 XP_005550182.1.63531 XP_011729245.1.29376 XP_011830120.1.47321 XP_011830121.1.47321 XP_011929378.1.92194 ENSPANP00000005086 ENSPANP00000014753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]