SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001253162.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001253162.1.72884
Domain Number 1 Region: 124-198
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 3.01e-29
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001253162.1.72884
Sequence length 200
Comment TSC22 domain family protein 3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGNSGENNNPGSPTVSNFRQLQEKLVFENL
NTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKI
EQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLS
PEEPAPESPQVPEAPGGSAV
Download sequence
Identical sequences A0A096MTF0 A0A2K5HZV3 A0A2K5LVG8 A0A2K5ZQ67 A0A2K6DSW3 F7GWQ1 G7Q3E9
NP_001253162.1.72884 XP_005594370.2.63531 XP_007990702.1.81039 XP_011754368.1.29376 XP_011754369.1.29376 XP_011754370.1.29376 XP_011754371.1.29376 XP_011754372.1.29376 XP_011754373.1.29376 XP_011754374.1.29376 XP_011754375.1.29376 XP_011814115.1.43180 XP_011814117.1.43180 XP_011814118.1.43180 XP_011814119.1.43180 XP_011825820.1.47321 XP_011825821.1.47321 XP_011825822.1.47321 XP_011825823.1.47321 XP_011886425.1.92194 XP_011886426.1.92194 XP_011886427.1.92194 XP_011886428.1.92194 XP_011886429.1.92194 XP_014983417.1.72884 XP_014983418.1.72884 XP_014983419.1.72884 XP_014983420.1.72884 XP_014983421.1.72884 XP_014983422.1.72884 XP_015299594.1.63531 XP_015299595.1.63531 9544.ENSMMUP00000040888 ENSMMUP00000010757 ENSMMUP00000010755 ENSMMUP00000040888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]