SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001260397.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001260397.1.81976
Domain Number 1 Region: 13-68
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000208
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001260397.1.81976
Sequence length 68
Comment uncharacterized protein Dmel_CG31704, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVLDCLIKEGRSI
TVEKKGRC
Download sequence
Identical sequences Q8IPA4
FBpp0079857 NP_001260397.1.81976 NP_723689.1.81976 FBpp0079857 FBpp0305613 FBpp0079857 7227.FBpp0079857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]