SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001261367.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001261367.1.81976
Domain Number 1 Region: 50-300
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-81
Family Calponin-homology domain, CH-domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 320-441
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-31
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 3094-3249
Classification Level Classification E-value
Superfamily Spectrin repeat 3.99e-30
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 4 Region: 2882-3038
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-30
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 5 Region: 2241-2401
Classification Level Classification E-value
Superfamily Spectrin repeat 3.16e-29
Family Spectrin repeat 0.00093
Further Details:      
 
Domain Number 6 Region: 1611-1761
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-29
Family Spectrin repeat 0.00044
Further Details:      
 
Domain Number 7 Region: 717-833
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 607-760
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-27
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 9 Region: 1825-1972
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-26
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 10 Region: 3212-3354
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-26
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 11 Region: 3798-3908
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-25
Family Pleckstrin-homology domain (PH domain) 0.00047
Further Details:      
 
Domain Number 12 Region: 3412-3565
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-25
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 13 Region: 1080-1234
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 14 Region: 2030-2185
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-23
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 2778-2916
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-22
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 16 Region: 1400-1517
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-22
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 17 Region: 1520-1651
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-21
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 18 Region: 2513-2617
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-20
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 19 Region: 2406-2509
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-17
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 20 Region: 1308-1445
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.00054
Further Details:      
 
Domain Number 21 Region: 991-1097
Classification Level Classification E-value
Superfamily Spectrin repeat 7.29e-16
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 22 Region: 2614-2729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000158
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 23 Region: 1240-1341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000475
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 24 Region: 864-940
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000101
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 25 Region: 458-547
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000106
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 26 Region: 3571-3668
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000389
Family Spectrin repeat 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001261367.1.81976
Sequence length 4321
Comment karst, isoform G [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEYNSVLRSNFSRNEYRRYISYERQSLASQYEPGGYSALQTPTPSNRNSANMTQRDGIIK
FENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEK
LGKPNSGRMRVHKIENVNKSLAFLHTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQ
EIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRP
DLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYH
TFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLE
GIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKA
WQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRYLRQVD
ATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLE
NQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVN
TYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHH
FMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGK
RLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNE
KIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSA
AEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKM
DKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKK
TILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQK
RHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEGEGVDNAKRKFEKFITDLSAASKR
VEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTC
DEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNA
YPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQL
NADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERL
KAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAI
LKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFER
KRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANE
GQLRNVTKDGQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRS
LEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAH
GGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPA
AKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQ
QLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAA
KLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLAS
QRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVE
VGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHR
FHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVR
LQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNL
RAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEE
KCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVE
DVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKD
LCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQ
AFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLE
EAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVK
HINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDV
DDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKK
YPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKK
MNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYL
LVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAV
ERLLKKHDEFEKLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEE
RKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSN
SPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFN
RSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQF
FQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQ
LVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYK
SELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVS
VQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRL
AKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSN
LNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQV
HVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAE
AAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWI
NEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHE
VEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGD
SIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKE
RLEQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSGPQSPALSQV
QLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKRTPSFTTRR
RAQSFRKNQKGEGFDLPPVEIQGSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKD
ENDFLQQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRK
ISFHASLPPNMQLLSYDESMKQQSSSSPDIKVTSSVESPVSSRNSSPDSQRRTSGAQVLD
GTATPQMAFLQRQMQQQQQQQQSQPSSPTGGFDQKPPIPPRGAAPVASHRQSQENLVVMR
NRQSSNDLQQSATLPAGLTGVQQNGNGKDDNALLTRNSEARQSDNPPPLPTTMPPVGGQH
QHPQNSHSHQNQHQAQVQQRINAFNAAASQQHQPDYFNNNTARQQPQRIPSGRIDSTRKF
IEMEAHNNNGGTSSSPKRSTINYSSSGASSNGNGNVKIGSGNSSTTTITTSTTTHQVTSS
SRTVWHLTSSPTSSTKSSSTGGSGEPSHAISNPSYMGWGNTRFESNRPVSLQPDSISFSR
VSAESSSESEAQSISSVSGVKGSKGTKEERRSGMFRIFGRKGDKEKEKDKDKRRSSQVPP
Q
Download sequence
Identical sequences M9PBL6
NP_001261367.1.81976 FBpp0304366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]