SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001261393.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001261393.1.81976
Domain Number - Region: 48-85
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0133
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001261393.1.81976
Sequence length 98
Comment Dpy-30-like 2, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPVSPGEGEVNGGGDVAKNDSNSQQSVDGIDAFAACQKPRPDTSSMPVRQYLDQTVAPIL
LHGLQALARDRPSDPISYLATYLLKNKNRCDEVKTEEN
Download sequence
Identical sequences Q9VZJ1
FBpp0073137 FBpp0073137 FBpp0073137 FBpp0305197 7227.FBpp0073137 NP_001261393.1.81976 NP_647854.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]