SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001262430.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001262430.1.81976
Domain Number 1 Region: 17-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-60
Family Calnexin/calreticulin 0.0000563
Further Details:      
 
Domain Number 2 Region: 201-314
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.97e-44
Family P-domain of calnexin/calreticulin 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001262430.1.81976
Sequence length 406
Comment calreticulin, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFVLTPGTFYNDA
EADKGIQTSQDARFYAASRKFDGFSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQT
DMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDN
TYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPE
HIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYV
PDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQAGEKKMKEAQ
DEVQRKKDEEEAKKASDKDDEDEDDDDEEKDDESKQDKDQSEHDEL
Download sequence
Identical sequences P29413 Q53YH3
7227.FBpp0081581 NP_001262430.1.81976 NP_524293.2.81976 FBpp0081581 FBpp0081581 FBpp0081581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]