SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001263985.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001263985.1.4139
Domain Number 1 Region: 686-881
Classification Level Classification E-value
Superfamily Sec7 domain 1.01e-75
Family Sec7 domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 443-626,1139-1154,1185-1528
Classification Level Classification E-value
Superfamily ARM repeat 7.07e-26
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001263985.1.4139
Sequence length 1846
Comment brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKVETEKQSPPHGEAKA
GSGTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGSAPDST
TPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQMERERHRQQHHLLQSPVSHHE
PESPHLRYLPPQTVDHIAQEQEGDLDPQTHDVDKSLQDDIEPENGSDISSAENEQTEADQ
ATAAETLSKDDVLCDGECEEKPQDIVQSIVEEMVDIIVGDMGEGTAVSASADGNAGAVED
GSDSENVQANGIPGTPISAAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKFSHILQKDA
FLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPVFRTNEMFINAIKQ
YLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSSFD
HKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMSNV
QELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQEISEIKHPETINRYG
SLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQEQ
GMLGTTPEDIAQFLHQEERLDSTQAGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRL
FLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQV
KNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSTKQNVAS
EKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVG
LQDCDDTDVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQKNI
DTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSLTGT
KDQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDF
VRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPN
EDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQM
VNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTSGHIVTLVFEKHFPATIDSFQDA
VKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVRGWF
PILFELSCVINRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPEQ
QTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSGTNC
LENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPTSGEAAPPSPSAMSEKQLD
AISQKSVDIHDSAQPRSSDNRQQAPLVSVSPASEEVSKGRPTAKFPEQKLFAALLIKCVV
QLELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVRVDTQDQGMYRFLTSQQLFKLL
DCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYTDESR
VSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDNRFKAHASFY
YPLLCEIMQFDLIPELRAVLRRFFLRIGIVFQISQPPEQELGINKQ
Download sequence
Identical sequences D4A631
10116.ENSRNOP00000007766 ENSRNOP00000007766 NP_001263985.1.100692 NP_001263985.1.4139 ENSRNOP00000007766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]