SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001264303.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001264303.1.86415
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.92e-24
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 
Domain Number 2 Region: 79-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000261
Family Cold shock DNA-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001264303.1.86415
Sequence length 206
Comment DNA-directed RNA polymerase III subunit RPC8 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MFVLVEMTDTVRIPPWQFERKLNESIAEELNKKLANKVVYNVGLCICLYDITKLEDSYIF
PGDGASHTKVHFRYVVFHPFLDEILVGEIKSCSQDGVHVSIGFFDDIVIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDIGEEIRFRVVDETFVDTSPTGPSSAEASTSNATEEVQ
KKEAPYTLVGSISEPGLGLLSWWTNS
Download sequence
Identical sequences E1BV29
ENSGALP00000019462 NP_001264303.1.86415 XP_003202346.1.16129 XP_015140579.1.86415 XP_019470056.1.16129 XP_021239878.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]