SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001275520.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001275520.1.87134
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.43e-39
Family SCAN domain 0.0000629
Further Details:      
 
Domain Number 2 Region: 224-273
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000471
Family KRAB domain (Kruppel-associated box) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001275520.1.87134
Sequence length 276
Comment zinc finger protein with KRAB and SCAN domains 7 isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAH
LEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDY
TQKKWKSLTLSQRALQWNMMPENHHSMASLGWSTMA
Download sequence
Identical sequences ENSP00000345404 ENSP00000416681 NP_001275520.1.87134 NP_001275520.1.92137 NP_079445.1.87134 NP_079445.1.92137 gi|47716685|ref|NP_079445.1| ENSP00000345404 ENSP00000416681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]