SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001288306.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001288306.1.954
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily SRF-like 7.19e-33
Family SRF-like 0.00022
Further Details:      
 
Weak hits

Sequence:  NP_001288306.1.954
Domain Number - Region: 94-174
Classification Level Classification E-value
Superfamily STAT 0.0392
Family STAT 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001288306.1.954
Sequence length 227
Comment MADS-box transcription factor 5-like [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFSTS
SCMYKTLERYRNCNSNSEATATPETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLGPLSM
KELEQLENQIEISLKHIRSTKSQQSLDQLFELKRKEQQLQDVNKDLRKKIQETSAENVLH
MSCQDVGPSGSTGHTNQANQQELFHPSVCDPSLHIGYQAYMDHLNND
Download sequence
Identical sequences I1H0S1
EG:BRADI1G48520.1 15368.BRADI1G48520.1 NP_001288306.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]