SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001291959.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001291959.1.62641
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.63e-45
Family MHC antigen-recognition domain 0.000015
Further Details:      
 
Domain Number 2 Region: 122-218
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-27
Family C1 set domains (antibody constant domain-like) 0.00000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001291959.1.62641
Sequence length 266
Comment DLA class II histocompatibility antigen, DR-1 beta chain precursor [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MVCLCFLGGSWMTALMLILMVLSPPLAWARDTPPHFLTMWKFECHYPNGTERVRYLVRYF
YNREELARFDSEVGEYRAVTELGRPDAKYWNGQKEVLERKHAEVDTVCRHNYGVFDSFLV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPLTVEWRAQSESAQSKMLSGIGGFVLGLL
FLVVGLFIYFRNQKGHSGLQPTGLLS
Download sequence
Identical sequences C6ZK78
NP_001291959.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]