SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001296247.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001296247.1.31192
Domain Number 1 Region: 338-467
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-26
Family Ran-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001296247.1.31192
Sequence length 469
Comment nuclear pore complex protein Nup50 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGFESDSGGAFKG
FKGLFVPSGGGGFSGFGSGAGGKPLEGLSNGNSVTGAPPFSSARAAAETKAAFGSIAANG
PTSLVDKKISNPKTNGDSQQPSSSGLTSSAAPVGNAYHKQLAALNCSVRDWIVKHVNTNP
LCDLTPIFKDYEKYLASIEQQHGNSGSSNSESEANKMSVETQSPSLFGSTKLQQESPFLF
HGNKTEDTSAKKLEAVSEKKTDPSLGATSASFNFGKKVDSSILGSLNSGPLTGFSFSSGN
SSLFGKDSTQNKPVPSPFSAKTLESPAEGGSNECKGGDEEENDEPPKVVVTEVKEEDAFY
SKKCKLFYKKDNEFKEKGVGTLHLKPTANQKTQLLVRADTNLGNILLNVLVPPNMPCART
GKNNVLIVCVPNPPVDEKNATIPVTMLIRVKTSEDADELHNILLEKKDV
Download sequence
Identical sequences F6XDP3
NP_001296247.1.31192 XP_005606830.1.31192 9796.ENSECAP00000014056 ENSECAP00000014056 ENSECAP00000014056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]