SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001305399.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001305399.1.87134
Domain Number 1 Region: 124-198
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 3.01e-29
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001305399.1.87134
Sequence length 200
Comment TSC22 domain family protein 3 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENL
NTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFHSASGASVVAIDNKI
EQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLS
PEEPAPESPQVPEAPGGSAV
Download sequence
Identical sequences K7ESR1
NYSGRC-37622903 ENSP00000314655 ENSP00000361458 ENSP00000361459 ENSP00000427427 ENSPPYP00000023578 NP_001305397.1.87134 NP_001305397.1.92137 NP_001305399.1.87134 NP_001305399.1.92137 NP_932174.1.87134 NP_932174.1.92137 XP_005262156.1.92137 XP_005262157.1.92137 XP_005262159.1.92137 XP_005262160.1.92137 XP_009233409.1.23681 XP_009233410.1.23681 XP_011529186.1.92137 XP_016884824.1.92137 ENSP00000314655 ENSP00000361458 ENSP00000361459 ENSP00000427427 9606.ENSP00000361458 ENSPPYP00000023074 gi|37622903|ref|NP_932174.1| ENSP00000314655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]