SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001305870.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001305870.1.92137
Domain Number 1 Region: 118-177
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000577
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily BPTI-like 1.09e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001305870.1.92137
Sequence length 251
Comment tissue factor pathway inhibitor isoform b precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQE
KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
GFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMF
FLGLDSISCLC
Download sequence
Identical sequences ENSP00000342306 ENSP00000386344 NP_001027452.1.87134 NP_001027452.1.92137 NP_001305870.1.87134 NP_001305870.1.92137 ENSP00000342306 ENSP00000386344 gi|73760409|ref|NP_001027452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]