SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001306247.1.100322 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001306247.1.100322
Domain Number 1 Region: 35-62,186-380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.42e-46
Family G proteins 0.000038
Further Details:      
 
Domain Number 2 Region: 66-191
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.09e-31
Family Transducin (alpha subunit), insertion domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001306247.1.100322
Sequence length 383
Comment guanine nucleotide-binding protein alpha-1 subunit [Brassica rapa]; AA=GCF_000309985.1; RF=representative genome; TAX=3711; STAX=3711; NAME=Brassica rapa; cultivar=Chiifu-401-42; AL=Chromosome; RT=Major
Sequence
MGLLCSRSRHHTEDTDENAQAAEIERRIEQEAKAEKHIRKLLLLGAGESGKSTIFKQIKL
LFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDPAKYTLSSENMAIGEKLS
EIGARLDYPRLTKDLAEGIETLWNDPAIQETCSRGNELQVPDCTKYLMENLKRLSDVNYI
PTKEDVLYARVRTTGVVEIQFSPVGENKKSGEVYRLFDVGGQRNERRKWIHLFEGVTAVI
FCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSIMLFLNKFDIFEKKVLDVP
LNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTALDQKL
VKKTFKLVDETLRRRNLLEAGLL
Download sequence
Identical sequences A0A088SI26 D0ENG7
NP_001306247.1.100322 XP_009117020.1.100322 XP_013663982.1.73403 XP_013663983.1.73403 XP_013663984.1.73403 XP_013663985.1.73403 XP_013663986.1.73403 XP_013663987.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]