SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001309005.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001309005.1.92137
Domain Number 1 Region: 36-121
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.88e-28
Family SCAN domain 0.00024
Further Details:      
 
Domain Number 2 Region: 392-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 433-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 354-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001309005.1.92137
Sequence length 495
Comment zinc finger and SCAN domain-containing protein 5A isoform c [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAANCTSSWSLGESCNRPGLELPRSMASSETQLGNHDVDPEISHVNFRMFSCPKESDPIQ
ALRKLTELCHLWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVMMNGVQSCKDLEDLLR
NNRRPKKWSVVTFHGKEYIVQDSDIEMAEAPSSVRDDLKDVSSQRASSVNQMRPGEGQAH
RELQILPRVPALSRRQGEDFLLHKSIDVTGDPKSLRPKQTLEKDLKENREENPGLTSPEP
QLPKSPNLVRAKEGKDPPKIASVENVDADTPSACVVEREASTHSGNRGDALNLSSPKRSK
PDASSISQEEPQGEATPVGNRESPGQAGMNSIHSPGPASPVSHPDGQEAKALPPFACDVC
EKRFTCNSKLVIHKRSHTGERLFQCNLCGKRFMQLISLQFHQRTHTGERPYTCDVCQKQF
TQKSYLKCHKRSHTGEKPFECKDCKKVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLK
LLRRHQKTHPEATSQ
Download sequence
Identical sequences A0A0C4DGQ1
ENSP00000467238 NP_001309002.1.87134 NP_001309002.1.92137 NP_001309003.1.87134 NP_001309003.1.92137 NP_001309004.1.87134 NP_001309004.1.92137 NP_001309005.1.87134 NP_001309005.1.92137 XP_016882788.1.92137 ENSP00000467238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]