SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001326441.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001326441.1.80155
Domain Number 1 Region: 58-146,230-295
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-17
Family Canonical RBD 0.0036
Further Details:      
 
Weak hits

Sequence:  NP_001326441.1.80155
Domain Number - Region: 30-44
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0144
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001326441.1.80155
Sequence length 339
Comment RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MAGAGIHPYHQQWPPAGAPPPPAAVSSAAPPHPPPIHHHPPPPPVLVDNHNRPPYDELRT
IFIAGLPDDVKERELLNLLRWLPGYEASQVNFKGEKPMGFALFSTAQFAMAAKDTLQHMV
FDAESKSVIHTEMAKKNLFVKRGIVGDSNAYDQSKRLRTGGDCTHSVYSPSPFHPPPPPV
WGPPHGYMAPAPPPYDPYAGYHAPPVPMPTPPPIAAPSSYVPVQNIKDNPPCNTLFIGNL
GENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHNLQGAVIPSSGS
IGMRIQYSKNPYGKRKEGGGYSFFPSPSANGAQGALTYQ
Download sequence
Identical sequences Q9ASW4
AT3G21215.1 AT3G21215.1 NP_001326439.1.80155 NP_001326441.1.80155 NP_683582.2.80155 3702.AT3G21215.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]