SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_002656.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_002656.1.92137
Domain Number 1 Region: 19-96
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.49e-20
Family Hairpin loop containing domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_002656.1.92137
Sequence length 96
Comment plasminogen-like protein B precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK
Download sequence
Identical sequences Q02325
GO.39040 ENSP00000347933 ENSP00000352458 ENSP00000347933 ENSP00000352458 ENSP00000386317 ENSP00000386505 ENSP00000386975 ENSP00000347933 ENSP00000352458 ENSP00000386317 ENSP00000386505 ENSP00000386975 9606.ENSP00000347933 9606.ENSP00000352458 gi|4505883|ref|NP_002656.1| gi|74048573|ref|NP_001027564.1| NP_001027564.1.87134 NP_001027564.1.92137 NP_002656.1.87134 NP_002656.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]