SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_012621.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_012621.1.97178
Domain Number 1 Region: 87-123,152-257
Classification Level Classification E-value
Superfamily TPR-like 0.00000000835
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_012621.1.97178
Sequence length 292
Comment Emc2p [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSALTEGNYFFLMEMLFYV
LVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYE
TDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFE
KACYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELY
LKGWALVNIISRELGRNKQNDLIKLSASKLKEISAKSNNKDKITAELILNKI
Download sequence
Identical sequences P47133
NP_012621.1.97178 YJR088C YJR088C 4932.YJR088C 355048 YJR088C YJR088C YJR088C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]