SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_031714.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_031714.1.92730
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.07e-53
Family Cofilin-like 0.000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_031714.1.92730
Sequence length 166
Comment cofilin-2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGSVVVSLEGKPL
Download sequence
Identical sequences M0RC65 P45591 Q3UHW9
ENSMUSP00000077262 10090.ENSMUSP00000077262 ENSMUSP00000077262 399848 ENSRNOP00000067174 NP_001102452.2.100692 NP_001102452.2.4139 NP_031714.1.92730 XP_021057959.1.100879 XP_021510908.1.76796 ENSMUSP00000077262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]