SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_035840.3.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_035840.3.92730
Domain Number 1 Region: 87-468
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9e-111
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000000112
Further Details:      
 
Domain Number 2 Region: 14-68
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000161
Family a tRNA synthase domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_035840.3.92730
Sequence length 481
Comment tryptophan--tRNA ligase, cytoplasmic isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MADMPSGESCTSPLELFNSIATQGELVRSLKAGNAPKDEIDSAVKMLLSLKMSYKAAMGE
EYKAGCPPGNPTAGRNCDSDATKASEDFVDPWTVRTSSAKGIDYDKLIVQFGSSKIDKEL
INRIERATGQRPHRFLRRGIFFSHRDMNQILDAYENKKPFYLYTGRGPSSEAMHLGHLVP
FIFTKWLQDVFNVPLVIQMSDDEKYLWKDLTLEQAYSYTVENAKDIIACGFDINKTFIFS
DLEYMGQSPGFYRNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAVQAAPSFSNSFPKI
FRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGHPKPALLHSTFFPALQGAQTKMSASDPN
SSIFLTDTAKQIKSKVNKHAFSGGRDTVEEHRQFGGNCEVDVSFMYLTFFLEDDDRLEQI
RKDYTSGAMLTGELKKTLIDVLQPLIAEHQARRKAVTEETVKEFMTPRQLSFHFQCFCFD
T
Download sequence
Identical sequences P32921
NP_035840.3.92730 XP_006515882.1.92730 ENSMUSP00000124649 ENSMUSP00000124625 10090.ENSMUSP00000077842 ENSMUSP00000124625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]